
From Wikipedia, the free encyclopedia
Jump to navigation Jump to search

Original file(SVG file, nominally 87 × 87 pixels, file size: 41 KB)

Commons-logo.svg This is a file from the Wikimedia Commons. The description on its description page there is shown below.
Commons is a freely licensed media file repository. You can help.

An icon for science stubs on :en.

Date 2004-11-28; 2008-02-14
Source en:Image:Science-symbol2.png
Author en:User:AllyUnion, User:Stannered
(Reusing this file)

The original image has been released into the public domain by its author, AllyUnion, at the English Wikipedia project. I, the creator of this derivative work, hereby release my modifications under the following licenses:

w:en:Creative Commons
This file is licensed under the Creative Commons Attribution 3.0 Unported license.
You are free:
  • to share – to copy, distribute and transmit the work
  • to remix – to adapt the work
Under the following conditions:
  • attribution – You must give appropriate credit, provide a link to the license, and indicate if changes were made. You may do so in any reasonable manner, but not in any way that suggests the licensor endorses you or your use.

GNU head Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.2 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled GNU Free Documentation License.
Other versions

Derivative works of this file: Wikinews Ciência.png en:Image:Science-symbol2.png

Cafkfkcjdkckdkckdkcskckskfkdkckdkckdllapwpgodlcmdkfkdkckdkfkckgkdkfkdkdkskdifkfkfkgkdkfkfkfkdkfkfkslglqwefkckdkgkkgtegory:Created with Inkcnsncndkckdscape Caxmvkdkcktegory:Bohr model icons

File history

Click on a date/time to view the file as it appeared at that time.

current21:08, 14 February 2008Thumbnail for version as of 21:08, 14 February 200887 × 87 (41 KB)Stannered{{Information |Description=An icon for science stubs on :en. |Source=en:Image:Science-symbol2.png |Date=2004-11-28; 2008-02-14 |Author=en:User:AllyUnion, User:Stannered |Permission=The original image has been released into the public domain

Global file usage